GenomeNet

>bmy:Bm1_04175 Histone deacetylase family protein; K11406 histone deacetylase 4/5 [EC:3.5.1.98] (A)
MENQQQSYTTATVEGPSTAPFGIASDAIDEERLAVLQQIYQQKQVELLSQYQQAQTNLAM
QHFTYFQALQTSQQQKQQQQQQQQQQKQSLHDTKTSEQTSSISTLDISEDSDTQVSPSTK
DCAGLRNKRSYSGSGQTISQLTKERLKTMITSKMNRIRSESSNVSQATTTVWTTSAASST
TNFGSQQMHTASSVQTPIALSSLHFEPYYIPSTMHAVHGTLQPSDYQLRKVWYMILNSTP
NNSLVYDPAMARHQCFCGNNRNHVEHGERVQSIWSRLQERGLVEKCERVFARKAPLEMLR
TVHAATYVTFFAVSPTACLKMEPSQLPVKSFVQLSCGGIGVDSDTYFNDASTQLAARIAV
GSLAELALQRCAEQCSRIAIIDWDVHHGNGTQICFEADPSVLYLSLHRHDNGNFFPGTGA
VTEVGVGSGKGYTVNIPFSGEMMDDADYLAAWRVIVAPILNQFKPTFIIVSAGFDAACGH
PQALGGYNLSPQLFGYFTLQLMNYAGGRVVLALEGGYDLDTISDSAEECVKALCGESPET
AGKLSDEALNAFPKQSAQETIQKVIAIHKKYWPSLTAAQGISSSELQWQAVAQKFASLSV

BLAST