GenomeNet

>bmy:Bm1_09745 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) glutamate decarboxylase, 67 kDa isoform (A)
MQSNNTSSSTNLTKIYAAELLPQNKRNWDSAKKFLEEIVKILLEYINEENQRENKILDFY
HPAEMQKLIDLSIPDNPRTLHQLLQDCREVLRLGVRTGHPRFFNQISCGLDLVSMAGEWL
TATANTNMFTYEIAPVFILMEKEVTKKMAELIGWQDSDAIFAPGGAISNLYAMNAARHSR
FPRCKPLGQSDLPTLCTFTSEDSHYSIKGAAAVMGIGTDNCFSIPTDPSGRMIPEALEQR
IIQCKKDGMEPFFVCATAGTTVYGAWDPIPQIADICDRHKLWLHVDAAWGGGLLLSPEHR
HKLCGIERANSVTWNPHKLMGALLQCSACFIKQEGLLFQTNQMSADYLFQQDKPYDVSFD
TGDKAMQCGRHNDIFKLWLMWRSK

BLAST