GenomeNet

>bmy:Bm1_09745 glutamate decarboxylase, 67 kDa isoform; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MQSNNTSSSTNLTKIYAAELLPQNKRNWDSAKKFLEEIVKILLEYINEENQRENKILDFY
HPAEMQKLIDLSIPDNPRTLHQLLQDCREVLRLGVRTGHPRFFNQISCGLDLVSMAGEWL
TATANTNMFTYEIAPVFILMEKEVTKKMAELIGWQDSDAIFAPGGAISNLYAMNAARHSR
FPRCKPLGQSDLPTLCTFTSEDSHYSIKGAAAVMGIGTDNCFSIPTDPSGRMIPEALEQR
IIQCKKDGMEPFFVCATAGTTVYGAWDPIPQIADICDRHKLWLHVDAAWGGGLLLSPEHR
HKLCGIERANSVTWNPHKLMGALLQCSACFIKQEGLLFQTNQMSADYLFQQDKPYDVSFD
TGDKAMQCGRHNDIFKLWLMWRSK

BLAST