GenomeNet

>bmy:Bm1_17690 K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial (A)
MIRCASNFCRTGNLVNQIARCASSTPPTGKRVKTFEIYRYNPEKPGSQPQLQKYDIDLDD
CGAMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGENTLACICKIDENTSKSTKI
YPLPHMFVIKDLVPDMNLFYAQYASIEPWLKKKNKLVLGEKQMFQTEKEREKLNGLYECI
LCACCSTSCPSYWWNADKYLGPAILLQSYRWMIDSRDDYAEERLSKIHDHFSVFKCHTIL
NCTKTCPKHLNPAKAIGEIKKLLTGFDKKPAPVAAPANF

BLAST