GenomeNet

>bmy:Bm1_31085 Angiotensin-converting enzyme family protein; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MTRRTLLIQQLIISVLLFGLYAQHGENSSGQNESRKETGMSTLENAFTSSKNSVIWPPTL
IQSTVNDALIIAEAETKNVFRTYSIAKQPDSLDMVPSQSHSTEFPHQSNSTPEPKVMLSS
SFHPSTYKPELHHQSMLTTTAKITRPFTDNSSHLAMQSAQSSQLTVHAEDSQPVTEPSDM
KLSNAFEDDAERFDEDDSNNADSSKPSAIDNEAIEELVNRFLNSDAAEDGKDEKLNKEAL
KLINSSKYWDVSNLEPEGSIRDSKKAQEWMNGYAVEAQKVLREVALAGWNYVTSVSHLTK
QLLDEAEETLGKFVKSSSKQAKQFDIAAIEDKSLKRQFELLLVEGINALDENDFNEYNEL
QKLIAKAYAETSVCETDNATICPYRVPDIVSIIAHENDGPKAFRLWIALRDALGPKLVTS
YKRLIELINKGAKLNGFSDGGAMWRSPYELLVSRQEKAEQSDTVVLLQKLYQQINPFYKQ
LHAYIRRQIPALYGLTNVSSLTRDGPIPAHLLKSIAGDNWIAFYRDTKPFQDEDDLAREV
QDNFQKRNYTVKNMFKQTYKTLKQIGFDKLPSSFWTKSIFTRTWSRDMLCYPPAAYDMRN
ELDYRVKACAHLNLPDFELTHKLLVHIYYYYMCREQPLLFREATNPSFLTAVTNAFAINA
RNIEYLKMMKLITSETGFSRSKIINRLYMEALEDFVKLPFDFAVDMWRFHIFDGTSTNVT
WNSDWWRLSELFQGIKSPVDRKSTDFDAIAFSTIAQTHAPAMKHFFAYIMQFQILKALCP
NATNLSNGCMLERSPAIDKIKKVMALGSSITWREALEIIIGSKEVDASAMLEYYQPLISW
LEEANAKEHVYIGWDGFGKPFTESEVPKLRENTASMDTFSEILSETQFAFPGGDCSNSRE
CLLDSVCRNNICECKEGLYTLRIGNTYNCVPGNPADAGFGDGHGGLVIGLHSADDSSVVP
IPEPEEHNKQLGAKPGSEHRNGRPGSLPEAELEHKGTSISIPTLILVLLFTVLIVLL

BLAST