GenomeNet

>bmy:Bm1_44425 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) Glutathione S-transferase, N-terminal domain containing protein (A)
MDEVFPNVPNRNQRRFANTTVLRKGIIKNRTWSEGVAQLLPRSINIRGLNSLALHRDSPE
PYSGLGTIHLYSMRFCPYAERAIIYLARKRLPVEITNINPENVPKWFLNKSPLGRVPTFE
MNGITIYESSVIAEYLDEIFPETAILPRHPVAKANQKILVERMSPLISTMFKILHPNNVT
VQQDVDKSLHNALRNAEVLLTDDFYGGKILGFADIMMWPFLERLQLVTVNPYTEFRYFPG
FYYPKISAYMARMQRQPEILFAQRPIEQHAAYVNSFLTGHPNYDIGINQS

BLAST