GenomeNet

>bmy:Bm1_55060 K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] | (RefSeq) SET domain containing protein (A)
MDTPNNSCNIGKRGIKNDGQVSRGAKRRCFKKDQLKEDVENEDSGEEKSFRGWKEDEDAP
LPKYLRDDVTRIYEDVMSRYRNMIDAEGLKLYHKMLQEEPRKKYIKCPSKCIEAVTSTPR
MQYWTLTECNILCEDERTLSHIPFLGDHEDDDIGFGEELLKTFQEGIHGTKVGCGSFIND
HILYQVLKKLFDKYSDVGIADQMIYRAVYEQFPNKASVQQLPFEDLKRRFGPSDLFIEDS
NQSEFLDTKALHSFQLLLCSRCLTYDCLIHGVNATETEVRRRRGVTSVEPCGLQCFRHLT
KEMEEAKRRCASPPDAKTINAILNIKTEDINWTAQQESMFIALRRTYKNDFCKLSEVLNL
VVGNAPSKSCRELYAYSFRTAPISPRADVSPNSPPKKKKNMKDQHRTFRAVKWAKTEGKV
GNTHVYEPCSHIGPCSAENNCSCVSVDNLCTKFCRCGEQCKYRFPGCRCAPGLCRTKQCQ
CFYANWECDPDVCKSCKCDILDDPNVATCKNVAMQRGLQKKLVIAPSQVAGWGCFAEEDI
EKNDFISEYCGEVISHDESERRGKIYDKLKCSYLFGLNDEMVVDATRKGNVIRFANHSKD
PNCMAKVFMVNGDHRIGIFARRPIVAGEELFFDYSYNSYQQVKFVSKERPKP

BLAST