GenomeNet

>bnc:BCN_3863 protein-glutamine gamma-glutamyltransferase; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIVIGRSIVHPYITNEYEPFANEKQQILSIMAGNQEIYSFRTSGELSFDLNLRVNIITSA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLALYEEETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYALNERRVPYAFISAFLTDTITRIDSR
LMSYHASPSTPQTSIGFIPIRDDAIVATVGNTTTVY

BLAST