GenomeNet

>bov:BOV_A0631 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (GenBank) aldehyde dehydrogenase family protein (A)
MLQKNLIQKTQFYIDGAWRSPVEEKTIEVMNPADEKPYAVISAGSAADIDLAVAAARRAF
PAWSETPAEERIAYIRRIAEIYESRLDEMAKTISMEMGAPIKLARESQAAAGLSHTKAFI
AACENFEVEEVLSPKYPNQTVVHEPIGVCGLITPWNWPMNQITLKVIPAIAVGCAVVLKP
SEIAPMSAMLFAEFVDQAGLPKGVFNLVNGEGPVVGEALSQHPEVDMMSFTGSTRAGTAV
SRAAAATVKRVSLELGGKSPNIVFADSDLEKAISRSLAHCFENTGQSCNAPTRMLVERSV
YDKAVELAKKAAESTKVGDPAQEGDHIGPLSSSIQFEKVQALIQKGIDEGARLVAGGTGR
PEGFTEGDYVKPTVFADVNNNMTIAREEIFGPVLAMIPFDTEEEAIAIANDTPYGLAAYI
QTGSPERAKRVARKLRAGMIQINGTSRAPGSPFGGYKQSGNGREGGKWGLEDFMEVKLIS
G

BLAST