GenomeNet

>bov:BOV_A0631 aldehyde dehydrogenase family protein; K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MLQKNLIQKTQFYIDGAWRSPVEEKTIEVMNPADEKPYAVISAGSAADIDLAVAAARRAF
PAWSETPAEERIAYIRRIAEIYESRLDEMAKTISMEMGAPIKLARESQAAAGLSHTKAFI
AACENFEVEEVLSPKYPNQTVVHEPIGVCGLITPWNWPMNQITLKVIPAIAVGCAVVLKP
SEIAPMSAMLFAEFVDQAGLPKGVFNLVNGEGPVVGEALSQHPEVDMMSFTGSTRAGTAV
SRAAAATVKRVSLELGGKSPNIVFADSDLEKAISRSLAHCFENTGQSCNAPTRMLVERSV
YDKAVELAKKAAESTKVGDPAQEGDHIGPLSSSIQFEKVQALIQKGIDEGARLVAGGTGR
PEGFTEGDYVKPTVFADVNNNMTIAREEIFGPVLAMIPFDTEEEAIAIANDTPYGLAAYI
QTGSPERAKRVARKLRAGMIQINGTSRAPGSPFGGYKQSGNGREGGKWGLEDFMEVKLIS
G

BLAST