GenomeNet

>bpd:BURPS668_A0019 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase family protein (EC:2.5.1.18) (A)
MLKLLGKAPSINVRKVLWTCAELKLAYEREDWGAGFRSTQTPEFLALNPNGLVPVLVDGD
FVLWESNAIIRYLANRYGGAHLYPVEPHARARVDQWLDWQTTALNRAWSYAFLALVRDAP
DHGDTARIRASCESWARHMAILDAQLGTTGAFVTGADYTLADVALGLSINRWLRTPFDKP
DFPAVSAYFDRLAARPGFAEHVDNGLP

BLAST