GenomeNet

>bper:BN118_3515 hypothetical protein; K01556 kynureninase [EC:3.7.1.3] (A)
MTTRQACLEADRRDPLAAFKDEFELPAGLIYLDGNSLGALPRGAAARAAQVIGQEWGQGL
IRSWNTAGWFELPARLGNKLAGLIGAGQDEVVMTDSTSLNIFKALAAALRLAQRAAPQRK
VIVSERDNFPTDLYMIQGMIDLLRQGYELRLVDAGLSLEQALDDDVAVVLLSHVNYRTGA
MHDMAAVSRRAHARGALIIWDLAHAAGAVPVALDADGADFAVGCTYKYLNGGPGSPAFIW
VAPRHRDDFWQPLSGWWGHRQPFEMADTYVPAQGIRRYLCGTQPIVSLATAECGLDIALR
ADIAQVRAKSLALGDRFIALVESRCADHPLTLATPREHARRGSHVSFLHPQGYAVMQALI
ARGVIGDYREPELLRFGLTPLYLSHADIWDAVEILREVLDTRAWDRPQYRERAAVT

BLAST