GenomeNet

>bpip:BPP43_07285 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MEKSDIKILFIYPNISYRGYFCRDKNVVFDKRIDIITEEELEDKFTNIENYLSNYDVVGI
DEFCFLNKTSEFIKLIKDFSRNNINIDFYIASLDMDFKRNYWESVSSLIEEDLIDVHIKV
FGKCDCGRKGIYSKRIVKDVDRIVIGDDIYKCVCRYCYEGEDEVKLNL

BLAST