GenomeNet

>bpj:B2904_orf441 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) neuraminidase (sialidase)-like protein (A)
MSKLKLFLILASSLLISCANPNDPGNDTTEGGNGAGGTTPDGKPSWYLSDAQQSSVYQPN
PVIAFDSKQGDIYRIAGIVETTKGTLVAVSDSRKTSESDVGFSGAANIDVVVKRSTDGGK
TWGQAVKIPPIAQKKEDSHGDPLIFSCKDGTLVVLCAAGNAWAQQYGTQNDSKIKMSKSI
DDGQSWSQWTEIQKVIYDNTTVQGKGFIKGFAASGRGYTDPDTGALYAAVLVGNYGHSKK
GTVVIKSVDNGTTWTVIGVLEDNGNDEPKVVTRIAEGTHTGKLLLSVRPSTADKRKFFLL
DENQGEASSISTYAEAGTFNDPTIDAEGMRYTLVKDGHAKNRILHVYLDNNSTRKNLSLV
MSEDEGKTWINNKVIQPDLAAYSSIIVLGDGTIGILAEEKNLDTASSSGTYDIVFRRFNL
KAFNGETYTQTW

BLAST