GenomeNet

>bpk:BBK_1104 alkaline phosphatase family protein; K01077 alkaline phosphatase [EC:3.1.3.1] (A)
MKRVRLAALLGASVFAAAGCGSDEPKTPGASDNGAQTGAARNVIFFLGDGMGMTTLTAAR
IYALGEDGALTLDTLPETAFVKTYSNDAQVTDSAPSMSAYMTGVKTNNEVISMTPDTKAI
EPSASLTGNCGANNGKPVPTLLEIAKAKGLATGVVTTTRVTHATPAATYAHVCHRDAEND
IAAQLVPGGAGYNAALGGGVDVVLGGGAQFFVPKEAGGKRADGRHLVNELKAKGYAIAQN
RDELLAADATKRGKLAGLFASSHMSYDLDRGATKEPSLADMATRALDVLQKNPNGYFLMV
EGGRIDHALHDTNAKRALQDTVAFDNAIKATLDKVRQTDPELKNTLIVVTADHDHTLVLN
GYAARTGKTEAGKPGVLGVLRNYQTGAVAKDADGAPYTIIGFGNGENRVQGSRAGTSLTD
AVTGADDYRQEAVVRMAKGGETHGGTDVFLGAIGRGADGFHGVIENNKVFELVRGAAQL

BLAST