GenomeNet

>bpl:BURPS1106A_2779 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase family protein (A)
MRVDGTRHTETAALLQRIGDLAGAGTLIPAHGTPARYEVIEWLTFVSSELHKTYSPWLFH
ADTADSTRRQCLEKLDRRLQEVDAHLATRDYLTGAFTVADAYLFAVANWSNFLRIPLAPY
PHLVAFMARVGARAKVGEALAAEGLGR

BLAST