GenomeNet

>bpm:BURPS1710b_A0240 no KO assigned | (GenBank) hypothetical protein (A)
MQEMSIEAGAPRDGGAALPRNTAYAGPAQMYGRRRRVRSRAAREGARLRVARAREPAHAA
ERCGGARRARAG

BLAST