GenomeNet

>bpo:BP951000_0923 neuraminidase (sialidase)-like protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MSKLKLFLILASALLISCANPNDPGNDTTEGGNGGGGTTPDGKPSWYLSDAQQSSVYQPN
PVIVFDSKQGDIYRIAGIVETTKGTLVAVSDSRKTSESDVGFSGAANIDVVVKRSTDGGK
TWGQAVKIPPIAQKKEDSHGDPLIFSCKDGTLVVLCAAGNAWAQQYGTQNDSKIKMSKSI
DDGQSWSQWTEIQKVIYDNTTVQGKGFIKGFAASGRGYTDPDTGALYAAVLVGNYGHSKK
GTVVIKSVDNGTTWTVIGVLEDNGNDEPKVVTRIAEGTHTGKLLLSVRPSTADKRKFFLL
DENQGEASSISTYAEAGTFNDPTIDAEGMRYTLVKDGHAKNRILHVYLDNNSTRKNLSLV
MSEDEGKTWINNKVIQPDLAAYSSIIVLGDGTIGILAEEKNLDTASSSGTYDIVFRRFNL
KAFNGETYTQTW

BLAST