GenomeNet

>bpo:BP951000_1592 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MFAGKSKYLIKTLDYLLMEKSDIKILFIYPNISYRGYFCRDKNVVFDKRIDIITEEELED
KFTNIENYLSNYDVVGIDEFCFLNKTSEFIKLIKDFSRNNINIDFYIASLDMDFKRNYWE
SVSSLIEEDLIDVHIKVFGKCDCGRKGIYSKRIVKDVDRIVIGDDIYKCVCRYCYEGEDE
VKLNL

BLAST