GenomeNet

>bps:BPSS0014 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) glutathione S-transferase like protein (A)
MLKLLGKAPSINVRKVLWTCAELKLAYEREDWGAGFRSTQTPEFLALNPNGLVPVLVDGD
FVLWESNAIIRYLANRYGGAHLYPVEPHARARVDQWLDWQTTALNRAWSYAFLALVRDAP
DHGDTARIRASCESWARHMAILDAQLGTTGAFVTGADYTLADVALGLSINRWLRTPFDKP
DFPAVSAYFDRLAARPGFAEHVDNGLP

BLAST