GenomeNet

>bps:BPSS2211 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (RefSeq) ATP-dependent DNA ligase (A)
MAGKLSVYRSRRRFGETPEPEGARRSPRRTKGAGRAGDESKRRARGDAAASSRGERGRSA
LHYVIQEHHARRLHYDFRLELDGTLKSWAIPKGPSLDPSVKRLAVHVEDHPLEYAAFEGE
IPEGHYGAGSVIIWDRGAWTPAGGVAAARAGYRAGKLSFMLDGDKLHGGWALVRSRGLRD
SGGKHEQWLLIKERDGDARDQADYDVLRARPGSVLGGARSARARRGRAAEPTERDAAAPK
RARASVPKGRAEAKTSGRAPRTVSNGTAGAGKGASKRASKRASKREGTNTGNGARSGKGN
GNGKGAGKGVATPRRKRAAAPQSSDVDSADTDSPAARGLALPAGLAARFGLSGAKRAALP
RTLRPQLATLVDAPPPGKDWLYEAKFDGYRVLIRIDRGAASRPIAVYTREGLDWSAKFAA
QLDALARLPVDRGWLDGEAVVLDRAGVPDFQALQNALGAGRSNDVTLFLFDVPFLNGFDL
RGVPLERRRALLAALVAAHASDVLRYSESLAFEAADLLTGACDAGLEGLIGKRRDGRYVE
GRSRSWIKLKCRRRQEFVIGGYTEPAGRRSGFGALLLGVYARAPGDEGDEGERRTRGAAE
TRDERRRASHASRTSRTSRTSRTSRTSRAPDAGAARAPQARPLALRYVGRVGTGFGERTL
RALARTLREHETGRMPFADVPRERSGTPVHWVKPVLVAECEFAEWTGDGIVRQASFVGLR
EDKPARTIVREQPQSMETEAMNEHADEHTDEHTDARAERRTGGRTRRKARDGGARDAPPL
ARHPKRGDAGSSARKGARDGEAGKRAAAGSSPSSSPSSSTSTSISASGRTRGGGRSASRD
RAGDADEGANEDANDHAPRERAGAPKVAGVRVSHPGRVIDPHTGTRKLDLVEYWEWIAPW
LLPHLKGRPVSLVRAPADIGGELFFQKHADKLEIPNVALHPGLDPGHEALITIDDVKGLV
GAAQMGTIELHTWNAHVSNIEKPDRAVFDLDPDPSLDWRAVIEAAQLTRALLDELGLVSF
CKTSGGKGLHVVVPLARHAGWDDVKAFAHAVARHMAATLPERFTATMGPRNRKGKIFVDY
LRNNRGASTIAAYSVRARPGLGVSVPIAWDELPDTTGAAQWTLANLHERLDALKHDPWRA
YAHVRQRVTAALRKRLSDG

BLAST