GenomeNet

>bpu:BPUM_0453 acoC; branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:1.8.1.4); K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MAVEVVMPKLGMSMKEGTVSVWNKEVGETVNKGESIASINSEKIEMEIESPAEGTILDIK
VPEGEGVPPGTVICYIGEGNEQVEEKKEKGLPPKQKKERIKISPVARKIAQSANLDIHTL
VGTGPDGRITKADVLRALPDEKEKQKQQNEPTKHQPVSMMRKTIASRMMESLQTSAQLTI
TMKADVTKLTNLQQQLNETAIARYETKLTITDFIAKAAILSLLEHPAMNSQYHNGVVETF
ENVHLGIAAALDNGLAVPVIQHAERLTLIELAKSIKLYGKKAREGKLLHDEIRGSTFTIT
NLGAYGVEHFTPILNPPEAGILGIGTMYDTPVYREDELCKGTILPLSLTFDHRVLDGAPA
SAFLSTVKAHLEEPISILL

BLAST