GenomeNet

>bpu:BPUM_0453 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) acoC; dihydrolipoyl dehydrogenase E2 subunit (A)
MAVEVVMPKLGMSMKEGTVSVWNKEVGETVNKGESIASINSEKIEMEIESPAEGTILDIK
VPEGEGVPPGTVICYIGEGNEQVEEKKEKGLPPKQKKERIKISPVARKIAQSANLDIHTL
VGTGPDGRITKADVLRALPDEKEKQKQQNEPTKHQPVSMMRKTIASRMMESLQTSAQLTI
TMKADVTKLTNLQQQLNETAIARYETKLTITDFIAKAAILSLLEHPAMNSQYHNGVVETF
ENVHLGIAAALDNGLAVPVIQHAERLTLIELAKSIKLYGKKAREGKLLHDEIRGSTFTIT
NLGAYGVEHFTPILNPPEAGILGIGTMYDTPVYREDELCKGTILPLSLTFDHRVLDGAPA
SAFLSTVKAHLEEPISILL

BLAST