GenomeNet

>bpu:BPUM_1666 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ykoU; possible DNA ligase (ATP) (A)
MKPMRLTAAHDVPTGADWVYELKYDGFRVILTWDQNEIHLESRAGKRLNEQFPEVIEQCE
QLRDHFAPLLPLTFDGELVFLLDEQQSDFARVQQRGRLKNKEAIKLQAERFPCHLIAFDL
LRCKGKSLIDLPLMERKTQLQQVFKAAKLPSSVQLEHPSLLQLIHTDTNSEHMKKLMTTY
LAEGLVAKKRTSKWHDHTRSKEWLKVKNWRYVSVIVTRFDKENGYFQGCIYQDHHLTEVV
QFKHGFSKEEEQTLRTLFQTNGKQTGASAYEIPPSIVASIACISFDGSALREPRFSSFLL
DTDPTACTFQQMLKQLYPLPTVIEITHPEKPIVPALHLNKADYLLYLRQAAPYLLPFLRE
RRLTLIRFPHGAGDEFFYQKSTPDYAPDYVLTDQADDIAYTVCNDPQTLLWLGNQLAMEF
HIPFETRDTDRPTEIVFDLDPPSVNEFHLAIEAAKRIKTLLDGLFLTAFIKTSGGKGLQV
YIPLKKNAFTYEETRTFTAFICQFLCEQAPELFTLERLKKKRGNRLYLDYIQHDAGKTII
APYSPRGNELGLVATPLEWDELRQDGLHPSLFTMPSVIERLKEKGDPFRRMRHLVNDDTF
RQVLHRLEDMIPAHKMDIRGH

BLAST