GenomeNet

>bpu:BPUM_2792 tgl; transglutaminase (EC:2.3.2.13); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIILSGQPVTNEQLASFQLEGQKRIILMQLQASNDTFRYRQASDLLFEVTLRSNIMNAAR
DLNKSGASFAIFQRSRANDAFWRVSEAGALELRYQVEPSRGIKDIFENGSQYAFECATAI
VIVFYMGVLQTVGDEKFNRRLRSLTLYDWHYDTLSIYTERGNDFIYGDCLYFENPEFSYQ
QSQWRGENVIYLGEDQYYGHGLGILTAAEIIDKLNKRRRPGAVQSAYLLPQTTRMDVIYL
RQMFGS

BLAST