GenomeNet

>bpw:WESB_2245 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) glycosyl hydrolase BNR repeat-containing protein (A)
MSKLKLFLILASALLISCANPNDPGDDGTGGGGTGTGGGTNKAGYVFPKGSLSQEEQQKD
LDPDSTMKVLFEKNDPKIGSKFFRIPALVVTKKGTIIAAADRRYDTPTDLGKGGIIDVVV
KTSSDMGNTWSDAITVLKATDSKSSYGDAFLMNAHDGSVLMGVVAEPGVQNKADTWIFKS
TDEGKTWAKIATLGTGSALYKDGTANRGFGASGQGLTLRYGQNKGKLMFAFFQWNSASGG
SGLSVSSIMSSDNGASWTKTGSIKPDRPDNNIDETKAIELSDGTILLNHRRSVSKGGRSW
SKSTDGGQNWTSEGLDPEVNDPGNNADFARYEFYGRPVKTSEYILMINSDGTANGTWFFN
RKRHTIRLTENEFNNGNPTQAGKYAYTKMLAKDGATRYSGYPTISVLPDGSIITLTEEET
ATERPAGGQFGAGGDDYDIIFRRFNLYWLSDGKEYVDYSKDALFQQPNP

BLAST