GenomeNet

>bpx:BUPH_00547 ribulose-bisphosphate carboxylase large subunit; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MNDFSQPAIESLHKPRNAGDPRERYAAGVMKYREMGYWQPDYTPKDTDVIALFRITPQPG
VEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPASNAGEPQYFAYIAYE
LDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERLDK
YGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENINSQAFMHWRDRFLFSMEA
VNRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAIQSMGRWAR
RNDMILHLHRAGHSTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLEGDPLTVQGF
YNVCREARNEVDLSRGLFFDQPWAGLRKVMPVASGGIHAGQMHQLLELFGDDAILQFGGG
TIGHPGGIQAGAVANRVALEAMVKARNEGRDIRHEGSDILEAAARWCGPLKQALDTWRDV
TFNYASTDSPDFAATPTAA

BLAST