GenomeNet

>bpy:Bphyt_5156 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) Glutathione S-transferase domain (A)
MIRFYFHPTPNPAKIALFLEETGLPYEVVPIDTSKGEQHTAQFRVINPNGKVPAIVDTEG
PGGKEARVFDSTAILLYLAEKTGNLQGAPQDRPELLSWLLFLASGLGPFSGQAVHFQFAA
PEGLDYAVNRYRREAERHYQVLNDHLEGRSYIVGETYTIADISAWGWLDRASRVLKGADD
PLAAFPNLRRLFETVDARPAVARARAVGKDHEFKKVNDEETRRALFPSNYSPVA

BLAST