GenomeNet

>bpz:BP1026B_II2379 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase (A)
MAGKLSVYRSRRRFGETPEPEGARRSPRRTKGAGRAGDESKRRARGDAAASSRGERAARR
GRAQQPAPARGRSALHYVIQEHHARRLHYDFRLELDGTLKSWAIPKGPSLDPSVKRLAVH
VEDHPLEYAAFEGEIPEGHYGAGSVIVWDRGAWTPAGGVAAARAGYRAGKLSFTLDGDKL
HGGWALVRGRGLRDSGGKHEQWLLIKERDGDARDQADYDVLRARPGSVLGGARSARARRG
RAAEPTERDAAAPKRARASVPKGRAEAKTSGRAPRTVSNGTAGAGKGASKRASKREGTNT
GNGARSGKGSGKGAGEGVATSRRKRAAAPQSSDVDSADTDSPAARGLALPAGLAARFGLS
GAKRAALPRTLRPQLATLVDTPPPGKDWLYEAKFDGYRVLIRIDRGAASRPIAVYTREGL
DWSAKFAAQLDALARLPVDRGWLDGEAVVLDRAGVPDFQALQNALGAGRSNDVTLFLFDV
PFLNGFDLRGVPLERRRALLAALVAAHASDVLRYSESLAFEAADLLTGACDAGLEGLIGK
RRDGRYVEGRSRSWIKLKCRRRQEFVIGGYTEPAGRRSGFGALLLGVYARAPGDEGERRT
RGAAETRDERRRASRTSRTSRAPDAGAARAPQARPLALRYVGRVGTGFGERTLRALARTL
REHETGRMPFADVPRERSGTPVHWVKPVLVAECEFAEWTGDGIVRQASFVGLREDKPART
IVREQPQSMETEAMNEHADEHTDEHTDARAERRTGGRTRRKARDGGARDAPPLARHPKRG
DAGSSARKGARDGEAGKRAAAGSSPSSSPSSSTSTSPSISASGRTRGGGRSASRDRAGDA
DEGANEGVNDHAPRERAGAPKVAGVRVSHPGRVIDPHTGTRKLDLVEYWEWIAPWLLPHL
KGRPVSLVRAPADIGGELFFQKHADKLEIPNVALHAGLDPGHEALITIDDVKGLVGAAQM
GTIELHTWNAHVSNIEKPDRAVFDLDPDPSLDWRAVIEAAQLTRALLDELGLVSFCKTSG
GKGLHVVVPLARHAGWDDVKAFAHAVARHMAATLPERFTATMGPRNRKGKIFVDYLRNNR
GASTIAAYSVRARPGLGVSVPIAWDELPDTTGAAQWTLANLHERLDALKHDPWRAYAHVR
QRVTAALRKRLSDG

BLAST