GenomeNet

>bql:LL3_03190 tgl; protein-glutamine gamma-glutamyltransferase (transglutaminase); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIIISGQVLRPQDIANWQTEESLVPYLNELINSPVQFDYGSITELMFEARLRRHIVEAAR
ELHGSGAKFATFAKTYGNTAYWRVTPEGALELKYRIPASKAIRDIIENGAFYAFECATAI
VVIYYLAVLKTIGEERFDRRFRDITLYDWHYEHLPIYTETGRHFLRGDCLYFKNPEFNPA
KAQWRGENVIVMGNDQYFAHGLGILTAEQIIQRLNSLRRKNAVQSAYLLSQATRLDAPAL
YQIMH

BLAST