GenomeNet

>bql:LL3_03854 tdk; thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVKVFKPAIDNRYSEEAVVSHNG
TSMTSHVISSSAEIWDHISESTDVIAVDEVQFFGESIIDDLSMLADKGYRVIAAGLDMDF
RGEPFGVVPDLMAVAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGASESYE
ARCRHHHEVPKKQTDK

BLAST