GenomeNet

>bqy:MUS_1417 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD; ATP-dependent DNA ligase (EC:6.5.1.1) (A)
MVLTMQPILTSVPPEGSEWRYEVKYDGFRCLLRIDESGVTLTSRNGQTLTNQFPEITAFA
ARCFQHMKDRFPITLDGELVYLINPYRADFEHLQIRGRLKRTEAIESTADRRPCRFLAFD
LLVLEGAGTVSLPYVKRKRALSKLFKEANLPACPHHLAEEAIQYIPEHTDFDALWAKVVR
HDGEGVVAKRASSGWAENKRSPDWQKYKHMKTAHVLLTGFNPKNGYVTASVLKDGTAVPI
ASVSHGMQAEEKNAVRTIMETHGKKLPSGEYILEPSICMTVQYLTILQDTLREVSFVSFQ
FEMDWTECTYQQLILRSKTLPPKLQFTSLDKIVFKKREKTKADFLSYMVKMSDFLMPFLK
DRAVTVIRYPHGAPGESFFQKNKPDYTPDFVSSVFDGSHEHIVCSSIPSLLWLANQLALE
FHVPFQTVHSERPAEIVIDLDPPSRNDFPMAVEAAHVLKQLFDSFSITSFPKLSGNKGIQ
LYIPLSPEAFSYEETRAFTMLIADYCVRTRPDLFTTERFIKNRNGRLYLDYLQHAEGKTI
IAPYSTRGNELGTVAAPLYWSEVNSSLTPDDYTIDTVVNRVRTEGDPFYDFYRNPQDGPL
SIVLEQIKRKS

BLAST