GenomeNet

>bqy:MUS_3406 tgl; protein-glutamine gamma-glutamyltransferase (EC:2.3.2.13); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIIISGQVLRPQDIANWQTEENLVPYINELLNSPVQFDYGSIAELMFEVRLRRHIVEAAR
ELHGSGVKFATFAKTYGNTAYWRVTPEGALELKYRIPASKAIRDIIENGAFYAFECATAI
VVIYYLAVLKTMGEERFNRRFRDITLYDWHYEHLPIYTETGSHFLRGDCLYFKNPDFNPA
KAQWRGENVIVMGNDQYFAHGLGILTAEQIIQRLNSLRKKNAVQPAYLLNQATRLDAPAL
YQIMH

BLAST