GenomeNet

>bra:BRADO0130 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) putative Glutathione S-transferase family protein (A)
MYTLYHHPFCPHSRFVRLVLGEYGLDLRLVEERAWERREAFLVLNPAATTPVLAVEDMPP
VPGVGVIAEFLDETCGVEAGDRRLMPATPAERIEVRRLMDWFNTKFFEEASNLLVTERIY
KRFMSEEDGGGPPSTDVIRAAKTNVRYHLAYIGWLAQRRNFLAGDRLTYADLAAAAHLSA
IDYLGDVPWIEDDAAKAWYARVKSRPSFRPLLSDWLAGVPASRTYVDLDF

BLAST