GenomeNet

>bra:BRADO0130 putative Glutathione S-transferase family protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MYTLYHHPFCPHSRFVRLVLGEYGLDLRLVEERAWERREAFLVLNPAATTPVLAVEDMPP
VPGVGVIAEFLDETCGVEAGDRRLMPATPAERIEVRRLMDWFNTKFFEEASNLLVTERIY
KRFMSEEDGGGPPSTDVIRAAKTNVRYHLAYIGWLAQRRNFLAGDRLTYADLAAAAHLSA
IDYLGDVPWIEDDAAKAWYARVKSRPSFRPLLSDWLAGVPASRTYVDLDF

BLAST