GenomeNet

>bra:BRADO1659 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) cbbL; Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit) (A)
MNDQSITVRGKDRYKSGVMEYKKMGYWEPSYQPNDTDVIALFRVTPQDGVDPVEACAAVA
GESSTATWTVVWTDRLTAAEKYRAKCYRVEPVPGSPGSYFAYIAYDLDLFEPGSIANLTA
SIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYCMEAVNKAQAATGEIKGT
YLNVTAATMEDMYERAEFAKELGSNIIMIDLVIGYTAIQSMAKWSRKNDMILHLHRAGHS
TYTRQRAHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNTTRGYYDICREDFNPMRLE
HGVFFDQHWASLNKLMPVASGGIHAGQMHQLLDLLGEDVVLQFGGGTIGHPRGIAAGATA
NRVALEAMILARNEGRDYVHEGPEILAKAAMTCTPLREALEIWKDVTFNYESTDSPDFVP
TVTPAA

BLAST