GenomeNet

>brh:RBRH_02824 K01841 phosphoenolpyruvate phosphomutase [EC:5.4.2.9] | (GenBank) Isocitrate lyase family protein / Nucleotidyltransferase family protein (A)
MDRNRFCRGCRARANAGTALAAAGGRGEHERITLRQELVEFMNAPDTFVARAPSRAARLR
RMLTSDKLEFMMEAHNGLSARIVREAGFDAIWASGLAISAQYGVRDNNEASWTQVVDTLE
FMVDASDLPILLDGDTGYGNFNNVRRLVKKLEQRGVAGVCIEDKQFPKTNSFIGGERQPL
ADVDEFCGKIKAGKDSQGDPDFSIVARVEALIAGWGMDEALRRAEAYHAAGADAILIHSK
LARADEIVAFAREWAHRAPLVIVPTKYYSTPTQVFRNAGISVVIWANHLIRAATSAMQAV
AKEIHDSETLVGVEDRVASVNEIFRLQGADEYSAAERVYLTARAPRTALVLAASRGRGLE
AVTAQRPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYRADAIDTAGIRLVVNERHET
TGELASLACATQAFEHDTVISYGDLLFRSYILHDLVESDAHFCVIVDSSQTQPTNQSVRD
FAYCSSGDDRGLFGQKVVLRRVSSEATAPDGTAPHGRWIGLLGVHGEGREKLQRIFATLR
ERGDFDSLDMPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRRAADFAHTQVPIAEASA
GGGND

BLAST