GenomeNet

>brh:RBRH_02824 isocitrate lyase family protein / nucleotidyltransferase family protein; K01841 phosphoenolpyruvate phosphomutase [EC:5.4.2.9] (A)
MDRNRFCRGCRARANAGTALAAAGGRGEHERITLRQELVEFMNAPDTFVARAPSRAARLR
RMLTSDKLEFMMEAHNGLSARIVREAGFDAIWASGLAISAQYGVRDNNEASWTQVVDTLE
FMVDASDLPILLDGDTGYGNFNNVRRLVKKLEQRGVAGVCIEDKQFPKTNSFIGGERQPL
ADVDEFCGKIKAGKDSQGDPDFSIVARVEALIAGWGMDEALRRAEAYHAAGADAILIHSK
LARADEIVAFAREWAHRAPLVIVPTKYYSTPTQVFRNAGISVVIWANHLIRAATSAMQAV
AKEIHDSETLVGVEDRVASVNEIFRLQGADEYSAAERVYLTARAPRTALVLAASRGRGLE
AVTAQRPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYRADAIDTAGIRLVVNERHET
TGELASLACATQAFEHDTVISYGDLLFRSYILHDLVESDAHFCVIVDSSQTQPTNQSVRD
FAYCSSGDDRGLFGQKVVLRRVSSEATAPDGTAPHGRWIGLLGVHGEGREKLQRIFATLR
ERGDFDSLDMPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRRAADFAHTQVPIAEASA
GGGND

BLAST