GenomeNet

>brm:Bmur_1914 glycosyl hydrolase family protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MKKNLIISFVLICAFVFAISCNNKNVTGAGGGNTGGSGGGSTVGSGYVLPAGSLSQEEQN
QPMDPNNNYTTLWTAGQGATGYRIPALAVTRNGVIVAAADRRHNGYQDLGKQNVIDVVVR
TSKDLGKTWSESKVVVQANNITDSYGDAFLMVDPVAKSTIYMGVVTEPGIQKKDINQTGI
TKIFRSTDDGATWSLWSTLDANSVIFKGGKAKPSTGFGASGQGVTLRYGQHKGKIMFAFF
GWGANSSGSSPLTVSAIVSSDGKTWENLGYLNSSTGGGDGNIDETKAIELSDGRILFNHR
RSVSAGGRSWSISSDGGASWQWLGKDPELVDPGNNADIFRYEYNGKRIKTDKYILYIHSD
QAPNGTWYQNRINHHVKLSVNELNNGAANTSGKFQYDRQLINDGMNTYSGYPTITVLPDG
TIATLTEELPKSQSKGTDHYNIVFRRFNLNWLTSGAESVNYSTDYLFQEAMN

BLAST