GenomeNet

>bsd:BLASA_0679 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) ppc; Phosphoenolpyruvate carboxylase, Carbon dioxide fixing enzyme (A)
MSEATVDVADLRHHGSAGPGGRADDEPLREDIRLLGRILGEVIGEHAGPDVLELVESTRL
EAFGVRRSEVDRVALAARLDGLDVRSANHIIRAFSHFSVLANLAEDIHHERRRRHHRRAG
SPPQRGSLAATFELLDRAGLSEDTVARELAGALVCPVVTAHPTEVRRKTVFQVQRQIAEL
IRQRDRAGGGDVDDEWSARMSRSVLTLWQTALLRLSRLRLEDEIDEALRYYELSLFDVVP
AINADLRRAVEERWPGAGVLRRPMLLPGSWIGGDRDGNPFVTADALRRATTRQAETALGH
HLAELAELRSELSMSDRLITSTPELYALADASGDDSPFRADEPYRRALTGITARLAATAL
RVLGTVPGGRVAGPDVVAYAVPDELRADLDVVDASLRSHGAGALADDRLRRLREAVEVFG
FHLCGLDLRQNSAVHEEVVAELLAWAGVCEDYAALDEVARVELLAGELTLRRPLVRPDAQ
LSEGARKELDVLLAAAGQVALLGPRTIPNYVVSMCESVSDVLEVAVLLKEVGLLDPGGVD
GPTCPVGISPLFETIGDLQAAASTLGAVLDQPLYRSLLGNRGDVQEVMLGYSDSNKDGGY
LAANWALYRAELDLVEVARREGIRLRLFHGRGGTVGRGGGPSYEAVRAQPPGAVAGALRI
TEQGEVIAAKYADPDLARRNLEALVAATLESTLLDVEGLGQDADEAYALLDDLAARAQLA
YRELVHETPGFVEWFRAATPIGELAELNIGSRPPSRKAGDSIADLRAIPWVFSWSQTRIM
LPGWYGTGSALESFVDGSPERLERLRDLHRRWPFFRTILSNMGMVLAKTDLGLAARYAGL
VPDEELRARVFDRIREEHERTCRMTRAITGEDDLLADNPSLARSIRNRFPYLEPLHHLQV
EMLRRRRSAVSGEDPDDELTSRNIQLTINGIATALRNSG

BLAST