GenomeNet

>bsd:BLASA_0679 ppc; phosphoenolpyruvate carboxylase, Carbon dioxide fixing enzyme (EC:4.1.1.31); K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MSEATVDVADLRHHGSAGPGGRADDEPLREDIRLLGRILGEVIGEHAGPDVLELVESTRL
EAFGVRRSEVDRVALAARLDGLDVRSANHIIRAFSHFSVLANLAEDIHHERRRRHHRRAG
SPPQRGSLAATFELLDRAGLSEDTVARELAGALVCPVVTAHPTEVRRKTVFQVQRQIAEL
IRQRDRAGGGDVDDEWSARMSRSVLTLWQTALLRLSRLRLEDEIDEALRYYELSLFDVVP
AINADLRRAVEERWPGAGVLRRPMLLPGSWIGGDRDGNPFVTADALRRATTRQAETALGH
HLAELAELRSELSMSDRLITSTPELYALADASGDDSPFRADEPYRRALTGITARLAATAL
RVLGTVPGGRVAGPDVVAYAVPDELRADLDVVDASLRSHGAGALADDRLRRLREAVEVFG
FHLCGLDLRQNSAVHEEVVAELLAWAGVCEDYAALDEVARVELLAGELTLRRPLVRPDAQ
LSEGARKELDVLLAAAGQVALLGPRTIPNYVVSMCESVSDVLEVAVLLKEVGLLDPGGVD
GPTCPVGISPLFETIGDLQAAASTLGAVLDQPLYRSLLGNRGDVQEVMLGYSDSNKDGGY
LAANWALYRAELDLVEVARREGIRLRLFHGRGGTVGRGGGPSYEAVRAQPPGAVAGALRI
TEQGEVIAAKYADPDLARRNLEALVAATLESTLLDVEGLGQDADEAYALLDDLAARAQLA
YRELVHETPGFVEWFRAATPIGELAELNIGSRPPSRKAGDSIADLRAIPWVFSWSQTRIM
LPGWYGTGSALESFVDGSPERLERLRDLHRRWPFFRTILSNMGMVLAKTDLGLAARYAGL
VPDEELRARVFDRIREEHERTCRMTRAITGEDDLLADNPSLARSIRNRFPYLEPLHHLQV
EMLRRRRSAVSGEDPDDELTSRNIQLTINGIATALRNSG

BLAST