GenomeNet

>bsd:BLASA_3263 no KO assigned | (GenBank) DNA polymerase LigD, polymerase domain (A)
MASSKDAVVLDVDGHEVRVSNPEKPYFPERGIRKIDVVEYFVAVGEGILFALEDRPTTLE
RWPGGVVEGARISTRTDNTGDAFYQKRVPKNAPPWVPTAHITFPSGRTADEIAPDSVAVV
AWCANLGTLTFHPWPVDRTDVESPNQIRIDLDPQPGTDFADAVRVAPHVRELLHEFGMQG
WPKTSGGRGVHIYVPIQPRWTFSEVRRAVIAFGRELERRLPDHVTMSWWKEERGEKIFLD
YNQMARDRTIASAYSIRPKPHAPVSAPVDWDELPDVSPFDFDVLTMPTRFREVGDKHAGL
AEHAFGIEPLLELAEKQETDAGLGDLPYPPDYPKMPGEPMRVQPSRARRPTSEES

BLAST