GenomeNet

>bse:Bsel_0416 glycoside hydrolase family 2 TIM barrel protein; K01190 beta-galactosidase [EC:3.2.1.23] (A)
MAMHEQTARRTYHPPENGYPEWNNNPELFQINREAPHADPRLYDTKEKAVAGDPDQVAWR
RSLNGTWSFLYADTPKERVEDFYTWDAGDERFTTVQVPGHLQLQGFDYPHYTNTRYPWEE
REDIKPPFAPVNYNPVGQYMRTFTMTGEPGDRPVYLRFEGVEAAFYLWINGTFAGYSEDS
FTPSEFEISDLVHAGENTVAVEVYHWCDSSWLEDQDFWRFSGIFRDVWLYETPAEQIRDY
TVKTSFHGTDGLLDLDVLIRRFKTKEVRELTVKADVYTYPDQKPVAEGAVTGSGDRMTLQ
ITVPDVLRWSAETPNLYIVVLTLQDEAGEAILYVHQKTGFQEFGLKDGLMTLNGAPLLFR
GVNRHEFMPDKGRAGITREEMEADLILMKQHNINAVRTSHYPNHPAFYELCDIYGLYVID
EVNMETHGTWVYGQEGIGETIPGNRPEWTENVLDRCRSLYERDKNATSVIIWSLGNESFG
GSNLKEMYDYFKEKDETRLVHYEGIFHYREYDASDMESTMYIPPHKVEDYAKEAEGNPDA
KPYILCEYSHAMGNSLGNFHKYTDLFLKYPILQGGFIWDWRDQALWSTRPDGTAFLAYGG
DFGDTPTDGNFSGNGLIFADGTATPKLLEAKKGYEPARIRFEGNHIHVTNDYAFLDLDGF
RCQWELLSDGKTVREGTLSLKGAPGSTHSYAVDLPETEGERILEVRLVLGEDTLWAEAGH
EMTFEQFILNDNGAPRSETPRGQANVSHDDGEWLSVAAGGVTYTFARDTGDLTEVTKDGK
QHLTAPVAPNFHRAMTDNDRGSGLPKRSAVWRKAGKNRRLNAFGVEESGESVHVTVDYAF
PDAGSSSMRVMYTLNGSGKAAVSFRFTPDNAMPEIPEVGLMMQLAPSLTELQWYGRGPHE
TYQDRFRSARIGIHESTVNERLTPYLKPQECGNMTGVRWLTLTNPDGSGIRITGSGDLEA
NALPYSPEELELATHQDRLPQPRHTVLRLNAAQMGVGGDDSWGQKTHDEYTLFTDRTFEA
SFDLTLI

BLAST