GenomeNet

>bse:Bsel_2005 glycerol-3-phosphate dehydrogenase anaerobic subunit A; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MKNMKTEAVVIGGGVTGAGVLRDLIMRGIPCILIEQKDLIHGTSSRNHGLLHSGARYAVR
DEEAAIESYTENLILKKIAKGSVEESGGLFVKVPGDDDAYVKQWVEACARVGIPIEEISL
ETALKEEPYINPAAEAVFRVPDGAVDPFTLVIDTVEDAIMRGAELLRYHEVIDIHQTNGQ
VNGLTVQNRYNREQINISADFVINAAGPWGEKVANMAGVDMKLINNKGTLTVLNQRINRQ
VINRLRMPGDADIFVPARDVTIFGTTGVNVQSPDDFSLDKTEIGQMIDEGAALIPNIREI
RTIRAFSGSRPLYQDEGTNDASGRNVTRGMALLDHEARDGLKGFITITGGKLTTFRYMAE
KTVDLICEKRGSAETCSTHEEAMTERHQPVSSIQVHTAALKKTSDWSGRRQSQIEEYLKT
ARGRTVICECEQVTWAEIKAAMPDDQPFHLGDIRRRTRLGMGPCQGSYCHKRAAALAVEE
GLVSPENAESALMEALSGRKKGMAVIEDTETDRQQEMMDAIYHISLGIPKGGHVHV

BLAST