GenomeNet

>bsh:BSU6051_31270 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; protein-glutamine gamma-glutamyltransferase Tgl (A)
MIIVSGQLLRPQDIENWQIDQDLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAK
TLHKSGAKFATFLKTYGNTTYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAI
VIIYYLALIDTIGEDKFNASFDRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQ
KAQWRGENVILLGEDKYFAHGLGILNGKQIIDKLNSFRKKGALQSAYLLSQATRLDVPSL
FRIVR

BLAST