GenomeNet

>bsk:BCA52141_II1575 glutathione S-transferase, N-terminal protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYLAINPRGAVPALEVEPG
VVITQNAAILQYIGDHSHVAAFKPAYGSLERARLQEALGFCSDLHGAFGGLFAPNLSEEA
RPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAVILGWGVGMKLDLNAYPKALR
LYERVLARPNVQKAMKEEGLI

BLAST