GenomeNet

>bsn:BSn5_06500 tgl; transglutaminase (EC:2.3.2.13); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIIVSGQLLRPQDIENWQIDQNLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAK
TLHKSGAKFATFLKTYGNTTYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAI
VIIYYLALIDTIGEDKFNASFDRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQ
KAQWRGENVILLGEDKYFAHGLGILNGKQIIDKLNSFRKKGALQSAYLLSQATRLDVPSL
FRIVR

BLAST