GenomeNet

>bsn:BSn5_09480 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEASVVSHNG
TSMTSYAISSAADIWDHISESTDVIAVDEVQFFDQEIVEVLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNIMAIAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGAAESYE
ARCRHHHEVPGKSKK

BLAST