GenomeNet

>bsr:I33_3214 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; spore coat protein and protein-glutamine gamma-glutamyltransferase Tgl (A)
MIIVSGQLLRPQDIENWQIDQNLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAK
TLHKSGAKFATFFKTYGNTTYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAI
VVIYYLALIDTIGEDKFNASFDRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQ
KAQWRGENVILLGEDKYFAHGLGILNGQQIIEKLNSFRKKGALQSAYLLSQATRLDVPSL
FRIVR

BLAST