GenomeNet

>bst:GYO_1664 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ykoU; spore germination DNA ligase YkoU (A)
MQPVLTSSPPIGAEWRYEVKYDGYRCILRIHSAGVTLTSRNGLELNSSFPEITQFAKTAF
LHMEKDLPLTLDGEIVCLVNPCRSDFEHIQVRGRLKRPDKIQESANARPCCFLAFDLLER
RGEDISPLSYLDRKKSLYDLMSAAKLPASPDPYAKETIQYIPCYDHFDPLWRMVTKFDGE
GIVAKKTNSKWLERKRSSDWLKYKNFKQAYVCITGFNPNNGFLTVSVLKNGVMTPIASVS
HGMRDEEKNAIREIMEQHGHKTSSGEFTLEPSICATVQYLTILQGTLREVSFVGFEFHMD
WTECTYAQVIRHSKSVHPKLQFTSLDKIIFEKNKKTKEDFIQYMIEVSDYLFPFLKNRAV
TVIRYPHGSRSESFFQKNKPDYAPDFVQSFYDGSHEHIVCEDMSTLLWLANQLALEFHVP
FQTIQSRRPAEIVIDLDPPSRDDFLMAVQAANELKRLFDSFGITSFPKLSGNKGIQLYIP
LSPEAFTYEETRQFTQLIAEYCTNAFPELFTTERLIKNRHGKLYLDYLQHAEGKTIICPY
STRGNDLGTVAAPLYWHEVQTSLTPAMFTIDTVVDRIKKQGCPFFDFYRNPQDEPLNAIL
HQLKKKS

BLAST