GenomeNet

>bst:GYO_3411 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; spore coat protein and protein-glutamine gamma-glutamyltransferase Tgl (EC:2.3.2.13) (A)
MIIVSGQLLRPQDIENWQIDENLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAK
TLHKSGAKFATFLKTYGNTAYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAI
VVIYYLALIDTIGEEKFDATFNRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQ
KAQWRGENVILLGEDKYFAHGLGILSGQQIIDKLNSFRRKGAIQPAYLLSQATRLDVPSL
YRIVR

BLAST