GenomeNet

>bsu:BSU09550 no KO assigned | (RefSeq) yhdP; hypothetical protein (A)
MDIVNLILVAVLIALTAFFVASEFAIIRIRGSRIDQLIAEGNKAAIAVKKVTTHLDEYLS
ACQLGITLTSIGLGVLGESTIERLLHPLFVQMNVPGSLSHVISFIFAYAIITFLHVVVGE
LAPKTVAIQKAEAVSMLFAKPLIWFYRIAFPFIWLLNNSARLLTKAFGLETVSENELAHS
EEELRIILSESYKSGEINQSEFKYVNKIFEFDDRLAKEIMIPRTEIVSLPHDIKISEMMD
IIQIEKYTRYPVEEGDKDNIIGVINIKEVLTACISGEVSVDSTISQFVNPIIHVIESAPI
QDLLVKMQKERVHMAILSDEYGGTAGLVTVEDIIEEIVGEIRDEFDIDEISEIRKIGEGH
YILDGKVLIDQVNDLLGIHLENEEVDTIGGWFLTQKYDVEKDDSIIEEGCEFIINEIDGH
HVAYIEVKKLQEEELLETANQQEA

BLAST