GenomeNet

>bsu:BSU19400 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (RefSeq) sodC; superoxide dismutase-like protein YojM (A)
MHRLLLLMMLTALGVAGCGQKKPPDPPNRVPEKKVVETSAFGHHVQLVNREGKAVGFIEI
KESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGH
HAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNS
GARIVCGALLGNNEKQ

BLAST