GenomeNet

>bsu:BSU19400 sodC; superoxide dismutase-like protein YojM (EC:1.15.1.1); K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MHRLLLLMMLTALGVAGCGQKKPPDPPNRVPEKKVVETSAFGHHVQLVNREGKAVGFIEI
KESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGH
HAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNS
GARIVCGALLGNNEKQ

BLAST