GenomeNet

>bsu:BSU20500 ligB; DNA ligase-like protein LigB (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MFVSPMLLHSIKEPFNDENYITELKFDGIRLILSKFDNQIKLYTRHNNEVTSKFPELMDL
DIPDGTVLDGEVIVAASGGAPDFEAVMERFMSKKSAHNIVYCVFDVIYKDGQSIAAKPLT
ERKTVLNSLELDHPNVFVIEGTQGNGLAYFNLAKEKNLEGIVIKKANSPYEINKRSHNWL
KVINYDYTEVLITGYTKKDIKFLLSYPDGTSAGFMEFMPHAERTKFHSMKQVKSESDEYV
FIEPILCNVKHRFKTKHGKLRIPSFESWRV

BLAST