GenomeNet

>bsu:BSU20610 no KO assigned | (RefSeq) yoqJ; hypothetical protein (A)
MKNPTMLKLKDKLLAVIEELITKENKYRFITGGALGTDQAACWCVHILKKKHPHIKNIIA
TPFKEQDKVWSADQKMWYKRMLNVADEIINVEELDKYKVSGEKPGEFSPAKMQKRNEYMI
DHSEAIVAVYDGSKSGTRNCLNYAKKTYLGHQLWRLHPDFNFELDITYFVG

BLAST