GenomeNet

>bsu:BSU25090 K05967 uncharacterized protein | (RefSeq) yqfW; nucleotidase YqfW (A)
MLRLGIDIDGTITAQDTFVPYLNRSFNLSISLNDMTDYDLTKLLNITQEEFWDWMNQNEA
IIYKEALLAQHAKQSLDLLKEEHKLIYITARRTHLTDITYEWFDRQNIHYDHIELVGGHH
KVEAVKNHNIDLFFEDHHGNAMMIAKEAGIPVILFNSPYNQLPIDSNIIRVNNWLEAVQW
MNNNKHHLIRVNN

BLAST